Stresscopin (Human) is a CRF-related peptide exhibiting defined helical and coil regions that engage class B GPCRs in research systems. Residue distribution provides amphipathic character and receptor-contact hot spots. Researchers investigate its conformational dynamics, proteolytic stability, and domain contributions. Applications include neuroendocrine signaling studies, receptor-ligand mapping, and peptide-analog design.
CAT No: R2760
Synonyms/Alias:CHEMBL511211; Stresscopin (human); BDBM50258641; FS109538; 6-(4-fluoro-2-(1H-pyrazol-5-yl)phenyl)-6,7-dihydro-5H-pyrrolo[1,2-a]imidazole; 352020-03-2; H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2; H-TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2
1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
2. The spatiotemporal control of signalling and trafficking of the GLP-1R
3. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.