Stresscopin (Human) is a CRF-related peptide exhibiting defined helical and coil regions that engage class B GPCRs in research systems. Residue distribution provides amphipathic character and receptor-contact hot spots. Researchers investigate its conformational dynamics, proteolytic stability, and domain contributions. Applications include neuroendocrine signaling studies, receptor-ligand mapping, and peptide-analog design.
CAT No: R2760
Synonyms/Alias:CHEMBL511211; Stresscopin (human); BDBM50258641; FS109538; 6-(4-fluoro-2-(1H-pyrazol-5-yl)phenyl)-6,7-dihydro-5H-pyrrolo[1,2-a]imidazole; 352020-03-2; H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2; H-TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2
Stresscopin (Human) is a synthetic peptide corresponding to the endogenous human neuropeptide, also known as urocortin III, which belongs to the corticotropin-releasing factor (CRF) peptide family. Characterized by its selective affinity for the CRF2 receptor, Stresscopin plays a pivotal role in modulating stress responses, anxiety, and neuroendocrine signaling within the central nervous system. Its structural and functional specificity makes it a valuable molecular tool for dissecting the mechanisms of CRF receptor subtype-selective signaling, as well as for investigating the physiological and biochemical pathways underlying stress adaptation and homeostatic regulation. The peptide's well-defined sequence and receptor selectivity have positioned it as an essential reagent for neurobiological and pharmacological research focused on peptide-receptor interactions and neuropeptide signaling networks.
Receptor pharmacology: Researchers utilize Stresscopin to interrogate CRF2 receptor pharmacology in vitro and in vivo. By serving as a highly selective agonist, the peptide enables precise mapping of CRF2-mediated signaling cascades, facilitating the differentiation of CRF1 and CRF2 receptor functions. Its application in receptor binding assays and signal transduction studies allows for the elucidation of downstream effectors, second messenger systems, and receptor desensitization or internalization processes, thereby advancing the understanding of peptide ligand-receptor dynamics in neuroendocrine regulation.
Neuropeptide signaling research: The use of this peptide in neuropeptide signaling studies is instrumental for unraveling the molecular underpinnings of stress-related pathways. Through in vitro neuronal culture experiments or ex vivo brain slice preparations, Stresscopin can be applied to evaluate its effects on neurotransmitter release, synaptic plasticity, and neuronal excitability. These investigations contribute to a more comprehensive understanding of how CRF family peptides orchestrate adaptive responses to environmental and physiological stressors at the cellular and network levels.
Peptide structure-activity relationship (SAR) studies: The defined sequence and receptor selectivity of Stresscopin make it an ideal template for structure-activity relationship analyses. By employing analogs and modified derivatives of the peptide, researchers can systematically probe the structural determinants of CRF2 receptor binding and activation. Such studies are critical for identifying key residues involved in ligand recognition, receptor activation, and functional selectivity, thus informing the rational design of novel peptide ligands or modulators with tailored pharmacological profiles.
Behavioral neuroscience: In preclinical research settings, Stresscopin is frequently utilized to explore the behavioral consequences of selective CRF2 receptor activation. Administration of the peptide in animal models enables the assessment of its impact on stress-related behaviors, anxiety-like phenotypes, and hypothalamic-pituitary-adrenal (HPA) axis modulation. These behavioral assays provide valuable insights into the neurobiological substrates of emotional regulation and adaptive coping mechanisms, supporting the broader field of stress neurobiology.
Peptide-based assay development: Stresscopin serves as a reference standard or positive control in the development and validation of peptide-based bioassays targeting the CRF2 receptor. Its consistent activity profile and receptor selectivity facilitate the optimization of assay conditions, calibration of detection systems, and benchmarking of novel peptide ligands or small-molecule modulators. This application is particularly relevant for high-throughput screening platforms and pharmacological profiling workflows aimed at identifying new modulators of CRF2-mediated signaling pathways.
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.