Stresscopin (Human)

Stresscopin (Human) is a CRF-related peptide exhibiting defined helical and coil regions that engage class B GPCRs in research systems. Residue distribution provides amphipathic character and receptor-contact hot spots. Researchers investigate its conformational dynamics, proteolytic stability, and domain contributions. Applications include neuroendocrine signaling studies, receptor-ligand mapping, and peptide-analog design.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2760

Synonyms/Alias:CHEMBL511211; Stresscopin (human); BDBM50258641; FS109538; 6-(4-fluoro-2-(1H-pyrazol-5-yl)phenyl)-6,7-dihydro-5H-pyrrolo[1,2-a]imidazole; 352020-03-2; H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2; H-TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C15H13FN4
M.W/Mr.
268.29

Stresscopin (Human), also known as urocortin 3, is a member of the corticotropin-releasing factor (CRF) peptide family, recognized for its involvement in the modulation of stress response pathways. As a naturally occurring neuropeptide, Stresscopin exhibits a distinct affinity for the CRF type 2 receptor (CRF2), distinguishing its physiological actions from other CRF-related peptides. Its unique receptor selectivity and distribution in peripheral and central tissues have made it a valuable tool for scientific investigations seeking to unravel the complexities of neuroendocrine regulation, emotional behavior, and metabolic processes. Researchers have shown increasing interest in this peptide due to its role in orchestrating the body's adaptive responses to various stressors, as well as its emerging significance in metabolic and cardiovascular research.

Neuroendocrine Stress Response: In the context of neuroendocrinology, urocortin 3 serves as a powerful probe for dissecting the molecular and cellular mechanisms underlying stress adaptation. By selectively activating CRF2 receptors, it allows researchers to distinguish between the roles of different CRF family members in hypothalamic-pituitary-adrenal (HPA) axis regulation. Experimental models employing this peptide enable the assessment of downstream signaling pathways, gene expression patterns, and the release of stress hormones. Such studies have advanced the understanding of how the central nervous system coordinates hormonal and behavioral responses to environmental challenges, providing insights into the physiological basis of resilience and vulnerability to stress-related disorders.

Behavioral Neuroscience: Stresscopin is widely utilized in behavioral neuroscience to evaluate its impact on anxiety-like and depressive behaviors in animal models. Its administration in specific brain regions or via systemic routes helps delineate the neural circuits and neurotransmitter systems influenced by CRF2 activation. By observing changes in locomotor activity, exploratory behavior, and social interactions, scientists can elucidate the peptide's role in modulating mood and emotional regulation. These investigations are instrumental in identifying potential molecular targets for future research into the mechanisms of emotional dysregulation and adaptive coping strategies.

Metabolic Regulation: The involvement of urocortin 3 in energy homeostasis and glucose metabolism has garnered significant attention. Research using this peptide has demonstrated its capacity to influence appetite, insulin secretion, and glucose uptake in peripheral tissues. Such findings highlight its potential as a molecular tool for exploring the crosstalk between stress signaling and metabolic pathways. By manipulating its levels in experimental systems, scientists can investigate the physiological consequences of altered CRF2 activity on body weight regulation, feeding behavior, and metabolic adaptation under various nutritional and environmental conditions.

Cardiovascular Research: Studies focusing on cardiovascular function have employed Stresscopin to probe its effects on heart rate, vascular tone, and cardiac contractility. Its presence in cardiac tissues and blood vessels suggests a modulatory role in cardiovascular homeostasis, particularly under stress conditions. Experimental applications include the evaluation of its influence on blood pressure regulation, vasodilation, and myocardial performance. These research directions contribute to a broader understanding of how neuropeptides integrate neural and peripheral signals to maintain cardiovascular stability in response to physiological demands.

Immunological Studies: The exploration of urocortin 3's effects on immune cell function represents an emerging area of interest. By interacting with CRF2 receptors expressed on immune cells, it may modulate cytokine production, cell migration, and inflammatory responses. Experimental models utilizing this peptide can help clarify the interplay between stress signaling and immune regulation, shedding light on the bidirectional communication between the nervous and immune systems. Such insights are valuable for advancing knowledge of how stress-related peptides influence immune competence and inflammatory processes.

In summary, Stresscopin (Human) stands as a multifaceted research tool with expanding applications across neuroendocrine, behavioral, metabolic, cardiovascular, and immunological domains. Its ability to selectively target CRF2 receptors provides a unique advantage for dissecting the specific contributions of CRF family peptides in diverse physiological processes. Ongoing investigations continue to reveal new dimensions of its biological significance, reinforcing its value in experimental paradigms designed to model complex interactions between stress, metabolism, cardiovascular function, and immune responses.

InChI
InChI=1S/C15H13FN4/c16-11-1-2-12(13(8-11)14-3-4-18-19-14)10-7-15-17-5-6-20(15)9-10/h1-6,8,10H,7,9H2,(H,18,19)
InChI Key
BXJSKCZBNVAQEJ-UHFFFAOYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide Synthesis ServicesCustom Conjugation ServicePeptide Modification ServicesPeptide CDMOPeptide Nucleic Acids SynthesiscGMP Peptide ServiceEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers