Tel: 1-631-624-4882
Email: info@creative-peptides.com

Stresscopin (Human)

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

cGMP Peptide

Registration of APIs CMC information required for an IND

IND and NDA support Drug master files (DMF) filing

Synonyms/AliasCHEMBL511211; Stresscopin (human); BDBM50258641; FS109538; 6-(4-fluoro-2-(1H-pyrazol-5-yl)phenyl)-6,7-dihydro-5H-pyrrolo[1,2-a]imidazole; 352020-03-2; H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2; H-TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2
M.F/FormulaC15H13FN4
M.W/Mr.268.29
InChIInChI=1S/C15H13FN4/c16-11-1-2-12(13(8-11)14-3-4-18-19-14)10-7-15-17-5-6-20(15)9-10/h1-6,8,10H,7,9H2,(H,18,19)
InChI KeyBXJSKCZBNVAQEJ-UHFFFAOYSA-N
Write a review Ask a question
My Review for Stresscopin (Human)

Required fields are marked with *

  • Basic Information
×
Ask a Question for Stresscopin (Human)

Required fields are marked with *

  • Basic Information
×
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Carbetocin

    Carbetocin is a long-acting synthetic agonist analogue of human oxytocin, with antihemorrhagic and uterotonic activities. Upon administration, carbetocin targets, binds to and activates peripheral oxytocin receptors that are present on the smooth musculature of the uterus. This causes uterus contractions and prevents excessive bleeding after childbirth, particularly following Cesarean section, and may be used to decrease blood loss during hysteroscopic myomectomy.

    Inquiry
  • Atosiban

    Atosiban is a nonapeptide, desamino-oxytocin analogue, and a competitive vasopressin/oxytocin receptor antagonist (VOTra). Atosiban is indicated to delay imminent pre-term birth in pregnant adult women. Atosiban is useful in improving the pregnancy outcome of in vitro fertilization-embryo transfer (IVF-ET) in patients with repeated implantation failure (RIF). The pregnancy rate improved from zero to 43.7%.

    Inquiry
  • Elcatonin Acetate

    Elcatonin acetate inhibits the absorption and autolysis of bones, thus leads to blood calcium descending. In addition, it inhibits the bone salts dissolving and transferring and promotes the excretion of calcium and phosphorus in urine.

    Inquiry
  • Thymopentin Acetate

    Thymopentin, also known as TP-5, is a synthetic derivative of thymopoietin, a thymic hormone, and has immunoregulatory properties. Thymopentin interacts with T cells, reduces endocrine and behavioral responses to experimental stress. It is also found to increase the number of cells undergoing apoptosis in irradiated cells and selectively bind to apoptotic cells.

    Inquiry
  • Thymosin β4 Acetate

    Thymosin β4 is a 43 amino acid peptide which is regarded as the main intracellular G-actin sequestering peptide. Extracellular thymosin β4 may contribute to physiological processes such as angiogenesis, wound healing and regulation of inflammation.

    Inquiry
  • Angiotensin II Acetate

    Angiotensin II is an octapeptide that produced from angiotensin I after the removal of two amino acids at the C-terminal by angiotensin-converting enzyme (ACE). Angiotensin II is mediated by AT1 and AT2 receptors, which are seven transmembrane glycoproteins with 30% sequence similarity.

    Inquiry
  • Fertirelin Acetate

    Fertirelin acetate is a potent LHRH agonist. After a transient increase, continuous administration results in downregulation of LH and FSH levels followed by a suppression of ovarian and testicular steroid biosynthesis.

    Inquiry
  • Terlipressin

    Terlipressin is a synthetic triglycyllysine derivative of vasopressin with vasoconstrictive, antihemorrhagic, and antidiuretic properties. Upon intravenous administration, terlipressin, an inactive prodrug, is biotransformed to its active moiety, lysine vasopressin (LVP), a nonselective vasopressin analogue with affinity for vasopressin receptors V1 (V1a), V2 and V3 (V1b). As a V1 agonist, terlipressin increases systemic vascular resistance, particularly in the splanchnic area, resulting in a decrease of portal pressure. V1 binding also promotes platelet aggregation and glycogenolysis, while V3 binding induces adrenocorticotropic hormone (ACTH) secretion. Compared to vasopressin, terlipressin has a minimal effect on V2 receptors, which are responsible for promotion of water reabsorption in the collecting ducts of the kidney via stimulation of cyclic AMP production.

    Inquiry
  • Icatibant

    Icatibant (Firazyr) is a synthetic peptidomimetic drug consisting of ten amino acids, and acts as an effective and specific antagonist of bradykinin B2 receptors. It has been approved in the EU for use in hereditary angioedema, and is under investigation for a number of other conditions in which bradykinin is thought to play a significant role.

    Inquiry
  • Gonadorelin Acetate

    Gonadorelin is a trophic peptide hormone responsible for the release of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) from the anterior pituitary. GnRH is synthesized and released from GnRH neurons within the hypothalamus. The peptide belongs to gonadotropin-releasing hormone family. It constitutes the initial step in the hypothalamic–pituitary–gonadal axis.

    Inquiry
  • Carbetocin

    Carbetocin is a long-acting synthetic agonist analogue of human oxytocin, with antihemorrhagic and uterotonic activities. Upon administration, carbetocin targets, binds to and activates peripheral oxytocin receptors that are present on the smooth musculature of the uterus. This causes uterus contractions and prevents excessive bleeding after childbirth, particularly following Cesarean section, and may be used to decrease blood loss during hysteroscopic myomectomy.

    Inquiry
  • Atosiban

    Atosiban is a nonapeptide, desamino-oxytocin analogue, and a competitive vasopressin/oxytocin receptor antagonist (VOTra). Atosiban is indicated to delay imminent pre-term birth in pregnant adult women. Atosiban is useful in improving the pregnancy outcome of in vitro fertilization-embryo transfer (IVF-ET) in patients with repeated implantation failure (RIF). The pregnancy rate improved from zero to 43.7%.

    Inquiry
  • Elcatonin Acetate

    Elcatonin acetate inhibits the absorption and autolysis of bones, thus leads to blood calcium descending. In addition, it inhibits the bone salts dissolving and transferring and promotes the excretion of calcium and phosphorus in urine.

    Inquiry
  • Thymopentin Acetate

    Thymopentin, also known as TP-5, is a synthetic derivative of thymopoietin, a thymic hormone, and has immunoregulatory properties. Thymopentin interacts with T cells, reduces endocrine and behavioral responses to experimental stress. It is also found to increase the number of cells undergoing apoptosis in irradiated cells and selectively bind to apoptotic cells.

    Inquiry
  • Thymosin β4 Acetate

    Thymosin β4 is a 43 amino acid peptide which is regarded as the main intracellular G-actin sequestering peptide. Extracellular thymosin β4 may contribute to physiological processes such as angiogenesis, wound healing and regulation of inflammation.

    Inquiry

About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

FAQ
Trusted By Over 1500

Our Customers

Get in touch with us

USA

Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA

Tel: 1-631-624-4882

Fax: 1-631-614-7828

Email: info@creative-peptides.com

 

Germany

Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main

Email: info@creative-peptides.com

Copyright © 2025 Creative Peptides. All rights reserved.