CAT# | S17004 |
Sequence | GWLRKAAKSVGKFYYKHKYYIKAAWQIGKHAL |
Length | 32 | Modifications | Leucine amide;6'-bromotryptophan(2);3,4-dihydroxyarginine(4);4,5-dihydroxylysine;3',4'-dihydroxyphenylalanine;5-hydroxylysine; |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
X02303 | PM_10200262 | Inquiry | ||
X17487 | TTPRF_HSVSMC | Inquiry | ||
X19668 | UP_P81829 | Inquiry | ||
X16079 | PM_9237904 | Inquiry | ||
X20515 | UP_Q25413 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...