Home > Product > Catalog Peptides > Others > Submaxillary gland androgen-regulated protein 3B

Others

Submaxillary gland androgen-regulated protein 3B

Price Inquiry
CAT#
S18001
Sequence
QRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP
Modifications
Pyrrolidone carboxylic acid(1)
Length
57

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.