Home > Product > Antimicrobial Peptides > Sushi peptide 3

Antimicrobial Peptides

Sushi peptide 3

Price Inquiry
CAT#
AF2364
Sequence
HAEHKVKIGVEQKYGQFPQGTEVTYTCSGNYFLM
Host Chemicals
Protein-derived peptide
Length
34
Activity
Gram-,

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.