Tamapin

Tamapin is a scorpion-derived peptide toxin rich in disulfide bonds that stabilize its compact fold. It interacts with potassium channels through structured loops containing charged and aromatic residues. Researchers analyze its binding determinants via electrophysiology. Applications include ion-channel mapping, toxin engineering, and disulfide-knot studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2835

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C146H238N44O41S6
M.W/Mr.
3458.11
Sequence
One Letter Code:AFCNLRRCELSCRSLGLLGKCIGEECKCVPY-NH2 (Disulfide bridge: Cys3-Cys21, Cys8-Cys26, Cys12-Cys28)
Three Letter Code: Ala-Phe-Cys-Asn-Leu-Arg-Arg-Cys-Glu-Leu-Ser-Cys-Arg-Ser-Leu-Gly-Leu-Leu-Gly-Lys-Cys-Ile-Gly-Glu-Glu-Cys-Lys-Cys-Val-Pro-Tyr-NH2 (Disulfide bridge: Cys3-Cys21, Cys8-Cys26, Cys12-Cys28)

Tamapin is a naturally derived peptide isolated from the venom of the Indian red scorpion, Mesobuthus tamulus, and is recognized for its potent and selective inhibition of small-conductance calcium-activated potassium (SK) channels. As a member of the scorpion toxin family, Tamapin displays a unique structural motif that enables precise interaction with SK channel subtypes, making it a valuable molecular tool in neurophysiology and ion channel research. The peptide's high affinity and specificity have positioned it as a critical agent in dissecting the functional roles of SK channels in various biological systems, especially within neuronal and cardiovascular contexts. Its stability, manageable size, and amenability to chemical modification further enhance its utility in experimental protocols aimed at elucidating complex signaling pathways involving potassium ion flux.

Electrophysiological Studies: In electrophysiology, Tamapin is widely employed to investigate the contribution of SK channels to neuronal excitability and synaptic transmission. By selectively blocking SK2 and SK3 channel subtypes, researchers can delineate the role of these channels in regulating action potential firing patterns, afterhyperpolarization phases, and overall neuronal responsiveness. Its application in patch-clamp experiments allows for the precise measurement of SK channel currents, facilitating the mapping of channel distribution and functional relevance in different brain regions. Such studies have advanced understanding of neuronal network dynamics and the molecular underpinnings of learning and memory processes.

Neuroscience Research: Within the field of neuroscience, Tamapin serves as a critical probe for unraveling the physiological significance of SK channels in central and peripheral nervous system function. Its use enables the selective inhibition of SK channel-mediated currents, offering insights into their involvement in modulating neurotransmitter release, synaptic plasticity, and neuroprotection against excitotoxicity. By applying Tamapin in cultured neurons or brain slice preparations, scientists can observe changes in synaptic efficacy and adaptative responses, thereby clarifying the channels' roles in cognitive and behavioral outcomes. This targeted approach has contributed substantially to the identification of molecular targets for the modulation of neural circuits.

Cardiac Electrophysiology: Cardiac research has benefited from Tamapin's ability to block SK channels, which are implicated in the regulation of cardiac action potentials and arrhythmogenic processes. The peptide's high specificity allows for the dissection of SK channel contributions to cardiac repolarization and rhythm stabilization. By applying Tamapin in isolated cardiac myocytes or tissue preparations, investigators can assess alterations in action potential duration and susceptibility to arrhythmias, providing mechanistic insight into the electrical properties of the heart. These findings have informed the broader understanding of cardiac ion channelopathies and potential avenues for therapeutic intervention.

Pharmacological Screening: In drug discovery and pharmacological profiling, Tamapin is utilized as a reference compound to evaluate the efficacy and selectivity of novel SK channel modulators. Its well-characterized inhibitory profile provides a benchmark for comparing new molecules, enabling high-throughput screening assays and structure-activity relationship studies. By incorporating Tamapin into screening platforms, researchers can identify lead compounds with desirable channel-blocking properties, accelerating the development of agents that target SK channel dysfunction in various pathological states.

Ion Channel Structure-Function Analysis: Structural biology and biochemistry laboratories employ Tamapin to probe the molecular determinants of SK channel gating and toxin-channel interactions. Through site-directed mutagenesis and peptide mapping experiments, the use of Tamapin helps elucidate the binding interfaces and conformational changes associated with SK channel inhibition. These investigations yield valuable information on peptide-channel recognition, informing the rational design of modified toxins or synthetic analogs with tailored properties for research or potential therapeutic applications.

In summary, Tamapin's unique ability to selectively inhibit SK channels has established it as an indispensable tool across multiple scientific disciplines. Its applications in electrophysiological analysis, neuroscience, cardiac research, pharmacological screening, and structural studies continue to drive advances in our understanding of potassium channel physiology and the development of targeted modulators for basic and translational research.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Analysis ServicesEpitope Mapping ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Synthesis ServicescGMP Peptide ServicePeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers