Tamapin

Tamapin is a scorpion-derived peptide toxin rich in disulfide bonds that stabilize its compact fold. It interacts with potassium channels through structured loops containing charged and aromatic residues. Researchers analyze its binding determinants via electrophysiology. Applications include ion-channel mapping, toxin engineering, and disulfide-knot studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2835

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C146H238N44O41S6
M.W/Mr.
3458.11
Sequence
One Letter Code:AFCNLRRCELSCRSLGLLGKCIGEECKCVPY-NH2 (Disulfide bridge: Cys3-Cys21, Cys8-Cys26, Cys12-Cys28)
Three Letter Code: Ala-Phe-Cys-Asn-Leu-Arg-Arg-Cys-Glu-Leu-Ser-Cys-Arg-Ser-Leu-Gly-Leu-Leu-Gly-Lys-Cys-Ile-Gly-Glu-Glu-Cys-Lys-Cys-Val-Pro-Tyr-NH2 (Disulfide bridge: Cys3-Cys21, Cys8-Cys26, Cys12-Cys28)

Tamapin is a peptide toxin originally isolated from the venom of the Indian red scorpion (Mesobuthus tamulus). As a small, structurally stable polypeptide, Tamapin is known for its high specificity and potency in modulating ion channel activity, particularly targeting small conductance calcium-activated potassium (SK) channels. Its unique molecular architecture and selective binding characteristics have made it an invaluable tool in neurophysiological research and ion channel pharmacology. The compound's ability to discriminate between closely related potassium channel subtypes provides researchers with a precise probe for dissecting the functional roles of SK channels in diverse cellular systems.

Ion Channel Research: Tamapin is widely utilized in the study of potassium ion channels, especially within the context of SK channel subtypes. Its high affinity and selectivity for SK2 channels enable detailed functional characterization of these channels in neuronal and non-neuronal tissues. By applying Tamapin in electrophysiological experiments such as patch-clamp assays, researchers can selectively inhibit SK2-mediated currents, allowing for the elucidation of channel-specific contributions to cellular excitability, synaptic transmission, and signal integration.

Neurophysiology Studies: The peptide serves as a critical molecular tool for investigating the physiological roles of SK channels in the central and peripheral nervous systems. Through the selective blockade of SK2 channels, Tamapin facilitates exploration of their involvement in regulating neuronal firing patterns, shaping afterhyperpolarization phases, and modulating synaptic plasticity. These studies are essential for advancing the understanding of neuronal circuitry and the mechanisms underlying learning, memory, and information processing.

Pharmacological Profiling: Tamapin's distinctive selectivity profile makes it a reference ligand in the pharmacological profiling of SK channel modulators. It is frequently employed in competitive binding assays and functional screening to benchmark the potency and specificity of novel compounds targeting SK channels. Such applications are instrumental in the development and validation of new chemical entities for basic research and drug discovery efforts focused on ion channel modulation.

Peptide Structure-Function Analysis: The defined sequence and disulfide-rich structure of Tamapin provide a model system for peptide engineering and structure-activity relationship studies. Researchers leverage its molecular framework to investigate the determinants of channel selectivity, binding affinity, and conformational stability in peptide toxins. Site-directed mutagenesis and synthetic analog development using Tamapin as a template yield insights into the structural features critical for bioactivity and channel interaction.

Venom Peptide Characterization: As a member of the scorpion toxin family, Tamapin is also employed in comparative studies aimed at characterizing the diversity and evolutionary relationships of venom-derived peptides. Its inclusion in proteomic and phylogenetic analyses supports efforts to map toxin families, understand their functional evolution, and identify novel bioactive sequences with potential research applications. Through such studies, Tamapin contributes to the broader field of toxinology and the exploration of natural peptide libraries as sources of molecular probes and research tools.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Analysis ServicesPeptide CDMOEpitope Mapping ServicescGMP Peptide ServicePeptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers