Tamapin

Tamapin is a scorpion-derived peptide toxin rich in disulfide bonds that stabilize its compact fold. It interacts with potassium channels through structured loops containing charged and aromatic residues. Researchers analyze its binding determinants via electrophysiology. Applications include ion-channel mapping, toxin engineering, and disulfide-knot studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2835

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C146H238N44O41S6
M.W/Mr.
3458.11
Sequence
One Letter Code:AFCNLRRCELSCRSLGLLGKCIGEECKCVPY-NH2 (Disulfide bridge: Cys3-Cys21, Cys8-Cys26, Cys12-Cys28)
Three Letter Code: Ala-Phe-Cys-Asn-Leu-Arg-Arg-Cys-Glu-Leu-Ser-Cys-Arg-Ser-Leu-Gly-Leu-Leu-Gly-Lys-Cys-Ile-Gly-Glu-Glu-Cys-Lys-Cys-Val-Pro-Tyr-NH2 (Disulfide bridge: Cys3-Cys21, Cys8-Cys26, Cys12-Cys28)

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Modification ServicesPeptide Analysis ServicesEpitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide Synthesis ServicesCustom Conjugation ServicePeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers