TAT-NSF700 Fusion Peptide

This peptide is the N-Ethyl-maleimide-sensitive factor (NSF) inhibitor fusion polypeptide composed of 11-amino acid cell permeable HIV transactivating regulatory protein(TAT) domain fused to a 22 amino acid NSF domain. TAT-NSF700 inhibits thrombin-induced exocytosis of endothelial cells in a dose-responsive manner.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: GR1223

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
4167
Sequence
One Letter Code:YGRKKRRQRRRGGGLLDYVPIGPRFSNLVLQALLVL
Three Letter Code:Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Leu-Leu-Asp-Tyr-Val-Pro-Ile-Gly-Pro-Arg-Phe-Ser-Asn-Leu-Val-Leu-Gln-Ala-Leu-Leu-Val-Leu
Long-term Storage Conditions
Freely soluble in water. Avoid repeated freezing and thawing.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesCustom Conjugation ServicePeptide Analysis ServicescGMP Peptide ServicePeptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide Modification ServicesPeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers