CAT# | AF1876 |
Sequence | ANFEIVNNCPYTVWAAASPGGGRRLDRGQT |
Activity | Antifungal |
Host Chemicals | Phaseolus vulgaris | Length | 30 | SwissProt ID | P83959 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1525 | Halibut Hb18 | Inquiry | ||
AF2241 | Brevinin-2DYa | Inquiry | ||
AF605 | Maximin s5 | Inquiry | ||
AF1324 | Ascaphin-6 | Inquiry | ||
AF377 | Halocidin precursorA | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
2. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
3. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
4. Myotropic activity of allatostatins in tenebrionid beetles
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
BIM 189 is one of the most potent bombesin antagonists known in the guinea pig and 3T3 cell systems but has 40% ...
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...
Trimetazidine is a partial fatty acid oxidation inhibitor that inhibits 3-ketoacyl CoA thiolase, one of the enzymes of fatty ...
MCL 0020 is a synthetic tripeptide with the structure of Ac-D-2Nal-Arg-2Nal-NH2 (2-Nal= 3-(2-naphthyl)-L-alanine ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...