Thymosin beta4(human, bovine, horse, rat)
Thymosin beta4(human, bovine, horse, rat)
Online Inquiry
| CAT# | T2814 |
| Chemical Structure |  |
| CAS | 77591-33-4 |
| Synonyms/Alias | FX (human, bovine, horse, rat) |
| M.F/Formula | C212H350N56O78S |
| M.W/Mr. | 4963.49 |
| Sequence | One Letter Code: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Biological Activity | Naturally occuring, potent regulator of actin polymerization present in human platelets at a concentration of 200 - 500 μM. Sequesters G-actin monomers in a 1:1 ratio (Kd = 0.7 - 1.0 μM) and allows rapid filament polymerization in the presence of profilin. Implicated in wound healing, induction of MMPs, chemotaxis, angiogenesis, inflammatory processes and tumor progression. |
| Length | 43 |
Storage | Desiccate at -20°C |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
Write a review
Ask a question
My Review for Thymosin beta4(human, bovine, horse, rat)
Required fields are marked with *
×
Ask a Question for Thymosin beta4(human, bovine, horse, rat)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
