Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C152H253N51O44S4 |
M.W/Mr. | 3627.3 |
Sequence | One Letter Code: YSPKMVQGSGCFGRKMDRLSSSSGLGCKVLRRH (Cys11 and 27 bridge) three Letter Code: H-Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Leu-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) |
Source# | Synthetic |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.