CAT# | B10003 |
M.F/Formula | C152H253N51O44S4 |
M.W/Mr. | 3627.26 |
Sequence | YSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Length | 33 | Modifications | disulfide |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
B10001 | Vasonatrin Peptide (1-27) | Inquiry | ||
B10006 | BNP-32, human | Inquiry | ||
B10009 | BNP-45, mouse | Inquiry | ||
B10007 | BNP-32, porcine | Inquiry | ||
B10010 | Biotinyl-BNP-32 (human) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...
MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...
Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...
An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...