CAT# | B10003 |
M.F/Formula | C152H253N51O44S4 |
M.W/Mr. | 3627.26 |
Sequence | YSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...
PMX-53, a chemically synthesized peptide material, is a potent C5a antagonist in human neutrophils and macrophag ...
IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...
Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...