Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C152H253N51O44S4 |
M.W/Mr. | 3627.26 |
Sequence | YSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Length | 33 |
Modifications | disulfide |
3. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
4. Emu oil in combination with other active ingredients for treating skin imperfections
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.