(Tyr0)-BNP-32 (human)

(Tyr0)-BNP-32 (human) is a modified form of brain natriuretic peptide that incorporates a tyrosine residue at the N-terminal, enhancing its stability and spectroscopic detectability. This modification does not disrupt the peptide's core function in regulating cardiovascular homeostasis. Its properties make it ideal for receptor-binding and functional assays. Researchers use it to investigate natriuretic peptide signaling and receptor activation mechanisms.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: B10003

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C152H253N51O44S4
M.W/Mr.
3627.26
Sequence
YSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Length
33
Modifications
disulfide

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide CDMOPeptide Modification ServicescGMP Peptide ServiceEpitope Mapping ServicesCustom Conjugation ServicePeptide Synthesis ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers