Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C162H267N51O48S3 |
M.W/Mr. | 3793.4 |
Sequence | One Letter Code: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Cys2 and 7 bridge) three Letter Code: H-Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 (trifluoroacetate salt)(Cys2 and 7 bridge) |
Source# | Synthetic |
2. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
5. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.