Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C194H303N59O53 |
M.W/Mr. | 4309.91 |
Sequence | AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY |
Length | 36 |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
2. The spatiotemporal control of signalling and trafficking of the GLP-1R
3. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.