Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | FTCAISCDIKVNGKPCKGSGEKKCSGGWSCKFNVCVKV |
Activity | Antifungal |
Host Chemicals | Avicularia juruensis |
Length | 38 |
SwissProt ID | B3EWQ0 |
1. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
4. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.