Urocortin III, human

Urocortin III, human is a corticotropin-related peptide with defined helical tendencies that support receptor-binding and motif-mapping studies. Its balanced hydrophobic and charged residues influence structural behavior. The sequence offers insight into regulatory peptide evolution. Researchers employ it in biochemical and conformational analyses.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: U02004

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C185H307N53O50S2
M.W/Mr.
4137.93
Sequence
FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2
Length
38

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide CDMOPeptide Modification ServicesPeptide Synthesis ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide Analysis ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers