Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGCR |
Activity | Antifungal |
Host Chemicals | Triticum kiharae |
Length | 45 |
2. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
4. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.