CAT# | AF2808 |
Sequence | ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCPI |
Activity | Antimicrobial |
Host Chemicals | Aedes albopictus | Length | 40 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF851 | Antifungal protein J | Inquiry | ||
AF371 | Temporin-1Gc | Inquiry | ||
AF1871 | Dermaseptin-3 | Inquiry | ||
AF325 | Amphipathic peptide CT2 | Inquiry | ||
AF2233 | Brevinin-2-OR2 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...
Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...
The peptide st-Ht31 P, A-kinase anchoring protein (AKAP) inhibitor, has the negative control for st-Ht31. In DRG ...
ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...
Eptifibatide acetate is a white or white-off powder, soluble in water and freely soluble in 1% acetic in water, ...