AalDefD

CAT#	AF2808
Sequence	ATCDLLSGFGVGDSACAAHCIARGNRGGYCNSKKVCVCPI
Activity	Antimicrobial

Host Chemicals	Aedes albopictus
Length	40

CAT#	Product Name	M.W	Molecular Formula	Inquiry
AF2483	Beta-defensin 1TB precursor			Inquiry
AF1960	Cathelicidin-BF antimicrobial peptide			Inquiry
AF351	Mastoparan B			Inquiry
AF3038	Bacteriocin microcin B17			Inquiry
AF021	Colutellin-A			Inquiry

1. GLP-1, exendin-4 and C-peptide regulate pancreatic islet microcirculation, insulin secretion and glucose tolerance in rats

2. Immune responses to peptides containing homocitrulline or citrulline in the DR4-transgenic mouse model of rheumatoid arthritis

3. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors

4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function

5. Effect of Probiotic Lactobacillus plantarum on Streptococcus mutans and Candida albicans Clinical Isolates from Children with Early Childhood Caries