Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | RYCERSSGTWSGVCGNTDKCSSQCQRLEGAAHGSCNYVFPAHKCICYYPC |
Activity | Fungi, |
Host Chemicals | Heliophila coronopifolia, South Africa |
Length | 50 |
1. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
4. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
5. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.