CAT# | A03023 |
M.F/Formula | C210H315N57O57S |
M.W/Mr. | 4582.23 |
Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF |
Length | 39 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
A03007 | [Glu10]-ACTH (1-17) | Inquiry | ||
A03015 | ACTH (1-10) | Inquiry | ||
A03013 | Acetyl-ACTH (4-24) (human, bovine, rat) | Inquiry | ||
A03030 | ACTH (3-24) (human, bovine, rat) | Inquiry | ||
A03021 | ACTH (12-39), rat | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
An overview of Tripeptide-10 Citrulline Signal oligopeptides are commonly synthesized from portions of EMPs and from natural ...
ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
PKC (19-36), a synthetic peptide of the pseudosubstrate domain of the kinase, is a selective inhibitor of prote ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...