Acthargel is a regulatory peptide featuring aromatic, hydrophobic, and charged residues arranged to support diverse conformational states. Researchers use it to probe folding dynamics, ligand-binding motifs, and peptide-protein interactions. The sequence encourages β-turn and extended-loop formation. Its structural adaptability aids mechanistic exploration.
CAT No: R2190
CAS No:9002-60-2
Synonyms/Alias:corticotropin;Corticotrophin;Cortrophin;Acthargel;9002-60-2;beta-Corticotropin;Adrenocorticotropin;Adrenocorticotrophin;H.P. Acthar gel;12427-33-7;Purified Cortrophin gel;ACTH (1-39);Corticotropin [USP:INN];beta-Corticotropin (swine);UNII-K0U68Q2TXA;K0U68Q2TXA;CHEBI:3892;BDBM82408;ACTH-(1-39);25-Asp-30-Gln-corticotropin porcine;NCGC00167127-01;DA-50244;DA-59356;CAS_12279-41-3;SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF;alpha1-39-Corticotropin (swine), 25-L-aspartic acid-30-L-glutamine;
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.