Acthargel is a regulatory peptide featuring aromatic, hydrophobic, and charged residues arranged to support diverse conformational states. Researchers use it to probe folding dynamics, ligand-binding motifs, and peptide-protein interactions. The sequence encourages β-turn and extended-loop formation. Its structural adaptability aids mechanistic exploration.
CAT No: R2190
CAS No:9002-60-2
Synonyms/Alias:corticotropin;Corticotrophin;Cortrophin;Acthargel;9002-60-2;beta-Corticotropin;Adrenocorticotropin;Adrenocorticotrophin;H.P. Acthar gel;12427-33-7;Purified Cortrophin gel;ACTH (1-39);Corticotropin [USP:INN];beta-Corticotropin (swine);UNII-K0U68Q2TXA;K0U68Q2TXA;CHEBI:3892;BDBM82408;ACTH-(1-39);25-Asp-30-Gln-corticotropin porcine;NCGC00167127-01;DA-50244;DA-59356;CAS_12279-41-3;SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF;alpha1-39-Corticotropin (swine), 25-L-aspartic acid-30-L-glutamine;
Acthargel is a synthetic peptide compound that functions as an analog of adrenocorticotropic hormone (ACTH). Structurally, it mimics the endogenous pituitary peptide responsible for regulating adrenal steroidogenesis through the activation of melanocortin receptors. Its biochemical properties make it a valuable tool for research in neuroendocrinology, peptide signaling pathways, and adrenal physiology. As a peptide-based reagent, Acthargel offers researchers the ability to probe complex hormonal cascades, study receptor-ligand interactions, and investigate peptide metabolism in controlled experimental settings.
Receptor Binding Studies: Acthargel is widely utilized in receptor binding assays to characterize the specificity and affinity of melanocortin receptors, particularly the MC2R subtype. By serving as a potent and selective ligand, it enables researchers to dissect the molecular mechanisms underlying ACTH-receptor interactions, facilitating the mapping of binding domains and elucidation of downstream signaling events. These studies are essential for advancing the understanding of peptide hormone-receptor dynamics and for the development of novel receptor modulators in basic and applied research.
Signal Transduction Analysis: In cellular and molecular biology laboratories, Acthargel serves as a reliable agonist for stimulating intracellular signaling pathways associated with ACTH activity. When applied to cultured adrenal or pituitary cells, it activates cyclic AMP (cAMP) production and other second messenger systems, providing a controlled means to study the regulation of steroidogenic enzyme expression, peptide-mediated gene transcription, and the integration of hormonal signals. Such applications are instrumental in unraveling the complexities of endocrine feedback loops and cellular response mechanisms.
Peptide Metabolism Research: The synthetic nature and defined sequence of Acthargel make it a suitable substrate for investigating peptide stability, degradation, and metabolic processing both in vitro and in cell-based assays. Researchers employ it to monitor proteolytic cleavage patterns, assess the activity of peptidases, and explore the fate of ACTH analogs under various physiological or experimental conditions. Insights gained from these studies contribute to a deeper understanding of peptide pharmacokinetics and the design of metabolically stable peptide therapeutics for research purposes.
Adrenal Function Assays: Acthargel is frequently incorporated into experimental protocols aimed at assessing adrenal gland responsiveness and steroid biosynthesis pathways. By acting as a functional surrogate for endogenous ACTH, it allows for the quantitative evaluation of steroidogenic output, measurement of hormone release kinetics, and the investigation of factors influencing adrenal cell sensitivity. These assays are critical for elucidating the regulation of glucocorticoid and mineralocorticoid synthesis in both normal and perturbed physiological states.
Peptide Synthesis and Analytical Validation: In peptide chemistry and analytical laboratories, Acthargel is employed as a reference standard or control in the development and validation of peptide synthesis protocols, chromatographic methods, and mass spectrometric analyses. Its well-characterized structure and predictable physicochemical properties make it ideal for calibrating instrumentation, optimizing purification strategies, and benchmarking analytical workflows. This application supports quality control efforts and enhances the reproducibility of peptide-based research methodologies across diverse scientific domains.
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.