Acthargel is a regulatory peptide featuring aromatic, hydrophobic, and charged residues arranged to support diverse conformational states. Researchers use it to probe folding dynamics, ligand-binding motifs, and peptide-protein interactions. The sequence encourages β-turn and extended-loop formation. Its structural adaptability aids mechanistic exploration.
CAT No: R2190
CAS No:9002-60-2
Synonyms/Alias:corticotropin;Corticotrophin;Cortrophin;Acthargel;9002-60-2;beta-Corticotropin;Adrenocorticotropin;Adrenocorticotrophin;H.P. Acthar gel;12427-33-7;Purified Cortrophin gel;ACTH (1-39);Corticotropin [USP:INN];beta-Corticotropin (swine);UNII-K0U68Q2TXA;K0U68Q2TXA;CHEBI:3892;BDBM82408;ACTH-(1-39);25-Asp-30-Gln-corticotropin porcine;NCGC00167127-01;DA-50244;DA-59356;CAS_12279-41-3;SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF;alpha1-39-Corticotropin (swine), 25-L-aspartic acid-30-L-glutamine;
Acthargel is a specialized carbohydrate compound recognized for its unique molecular structure and physicochemical properties, making it a valuable resource in a variety of scientific and industrial research settings. Derived from advanced carbohydrate chemistry techniques, Acthargel stands out for its remarkable solubility, viscosity modulation, and compatibility with a wide range of biomolecules. Its versatility enables researchers to explore novel formulations and mechanisms within both biological and material science contexts. The compound exhibits a high degree of stability under diverse experimental conditions, which enhances its suitability for reproducible and reliable research outcomes. Acthargel's neutral taste and inertness further contribute to its adaptability in sensitive experimental designs, ensuring minimal interference with other components or biological systems under investigation.
Pharmaceutical formulation development: As an excipient in drug delivery research, Acthargel is commonly utilized for its gel-forming capabilities and rheological control. Researchers leverage its ability to create stable, homogenous matrices that facilitate the encapsulation and controlled release of active pharmaceutical ingredients. The compound's compatibility with both hydrophilic and hydrophobic molecules allows for the design of innovative delivery systems, such as hydrogels and sustained-release platforms, supporting the optimization of bioavailability and targeted delivery. Its physicochemical stability ensures that formulations remain consistent throughout the course of experimental studies, providing reliable data for further development.
Biotechnological research: In the field of biotechnology, Acthargel serves as a critical medium component and scaffold material. Its gel-forming nature supports cell culture studies by providing a three-dimensional matrix that mimics the extracellular environment, promoting cell proliferation and differentiation. Scientists employ Acthargel to investigate cell-matrix interactions, tissue engineering constructs, and regenerative medicine applications at the preclinical research stage. Its inertness and biocompatibility are particularly advantageous for supporting the growth of sensitive cell lines, enabling the study of cellular responses to various stimuli or therapeutic agents without confounding background effects.
Food science and nutrition: The compound finds extensive utility in food research and product development, where it functions as a thickening and stabilizing agent. Acthargel's ability to modulate texture and viscosity is valuable in the formulation of novel food products, including low-calorie or specialized dietary items. Researchers exploit its water-binding capacity to improve the mouthfeel, consistency, and shelf-life of experimental food prototypes. Additionally, it is used to study the impact of hydrocolloids on nutrient release and absorption, supporting the development of functional foods tailored to specific nutritional profiles.
Cosmetic and personal care research: Within the cosmetic industry, Acthargel is explored as a rheology modifier and stabilizer in the formulation of creams, gels, and serums. Its high water retention and gelation properties enable the creation of products with desirable texture, spreadability, and sensory attributes. Researchers utilize it to investigate the stability of emulsions, the controlled release of active cosmetic ingredients, and the interaction with skin or hair substrates. The compound's inert profile ensures that it does not react adversely with sensitive actives or other formulation components, making it an ideal candidate for innovative cosmetic research.
Material science and polymer research: Acthargel's unique molecular architecture makes it an intriguing subject in the field of material science, particularly in the synthesis of hydrogels and composite materials. Scientists employ it as a functional additive to tailor the mechanical properties, swelling behavior, and porosity of polymer networks. The compound is used to study the development of smart materials with responsive characteristics, such as stimuli-sensitive gels for environmental or biomedical sensing applications. Its ability to form stable, reproducible networks supports the investigation of new material platforms with potential for use in filtration, encapsulation, and controlled-release systems.
Environmental and analytical applications: Environmental scientists utilize Acthargel as a matrix for immobilizing enzymes or microorganisms in bioremediation studies, capitalizing on its ability to provide a supportive environment for biological activity while maintaining structural integrity. In analytical chemistry, it is incorporated into sample preparation protocols, where its gel-forming capacity aids in the separation, concentration, or purification of analytes from complex matrices. The compound's stability and inertness minimize background interference, making it suitable for precise analytical measurements and reproducible experimental workflows. Across these diverse research domains, Acthargel continues to be a valued tool for advancing scientific understanding and technological innovation.
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.