Adrenomedullin (11-50), rat

Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1169

CAS No:163648-32-6

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₉₄H₃₀₄N₅₈O₅₉S₄
M.W/Mr.
4521.17
Sequence
One Letter Code: STGCRFGTCTMQKLAHQIYQFTDKDKDGMAP RNKISPQGY-NH2(Disulfide bridge: Cys4-Cys9)
three Letter Code: Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2(Disulfide bridge: Cys4-Cys9)

Adrenomedullin (11-50), rat is a synthetic peptide fragment derived from the rat adrenomedullin hormone, comprising amino acids 11 through 50 of the native sequence. As a biologically active peptide, it retains key structural motifs associated with the full-length adrenomedullin, a member of the calcitonin gene-related peptide (CGRP) family. This truncated form is widely utilized in biochemical and physiological research to probe the functional domains responsible for receptor interaction, vasodilatory activity, and signal transduction. Its relevance extends to studies of cardiovascular regulation, vascular biology, and peptide-receptor dynamics, making it a valuable tool for elucidating the mechanisms underlying adrenomedullin-mediated processes.

Peptide-receptor interaction studies: Researchers employ this peptide fragment to dissect the binding characteristics and structural requirements for adrenomedullin receptor activation. By isolating the 11-50 region, investigations can focus on identifying the minimal sequence necessary for receptor engagement and downstream signaling. Such studies are essential for mapping ligand-receptor interfaces, understanding selectivity among related peptides, and designing analogs with altered biological activity for experimental purposes.

Vascular biology research: The 11-50 fragment is frequently used to explore the vasodilatory properties attributed to adrenomedullin. Studies utilizing this peptide help clarify which portions of the molecule are critical for inducing smooth muscle relaxation and modulating vascular tone. Insights gained from these experiments contribute to a deeper understanding of the molecular mechanisms regulating blood flow, endothelial function, and vascular homeostasis in physiological and pathophysiological contexts.

Signal transduction analysis: Investigators leverage this peptide to delineate the intracellular signaling pathways activated upon receptor engagement. By applying the fragment in cell-based assays, it is possible to monitor second messenger systems, phosphorylation events, and gene expression profiles specific to adrenomedullin signaling. These analyses are instrumental in unraveling the complexity of G protein-coupled receptor (GPCR) signaling and its modulation by peptide ligands.

Structure-activity relationship (SAR) studies: The truncated peptide serves as a model system for SAR investigations aimed at pinpointing the structural determinants of biological activity. Systematic modifications and comparative assays using the 11-50 sequence allow researchers to assess the impact of specific amino acid residues or secondary structural elements on potency, efficacy, and receptor selectivity. Such work supports rational peptide design and the development of novel research tools.

Peptide synthesis validation: As a well-characterized fragment, this peptide is often used as a reference standard in peptide synthesis and analytical workflows. Its defined sequence and known biological properties make it suitable for validating synthetic protocols, optimizing purification strategies, and calibrating analytical instrumentation. This application underpins quality assurance in peptide production and supports the broader field of synthetic peptide research.

Length
40
Modifications
Disulfide

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide CDMOcGMP Peptide ServicePeptide Modification ServicesCustom Conjugation ServiceEpitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers