Keywords Search Google Search Search

Adrenomedullin 5 (primate) trifluoroacetate salt

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A05023
CAS	1816939-48-6
M.F/Formula	C111H177N37O28
M.W/Mr.	5784.55
Sequence	One Letter Code: HQVPQHRGHVCYLGVCRTHRLAEIIQWIRSASTKEPTGKASREPQNPYSY-NH₂ three Letter Code: H-His-Gln-Val-Pro-Gln-His-Arg-Gly-His-Val-Cys-Tyr-Leu-Gly-Val-Cys-Arg-Thr-His-Arg-Leu-Ala-Glu-Ile-Ile-Gln-Trp-Ile-Arg-Ser-Ala-Ser-Thr-Lys-Glu-Pro-Thr-Gly-Lys-Ala-Ser-Arg-Glu-Pro-Gln-Asn-Pro-Tyr-Ser-Tyr-NH₂ trifluoroacetate salt (Disulfide bond)

CAT#	Product Name	Inquiry
A05012	Adrenomedullin (22-52), human	Inquiry
A05022	Adrenomedullin (rat) trifluoroacetate salt	Inquiry
A05015	Proadrenomedullin N-terminal 20 Peptide (Human, 9-20)	Inquiry
A05008	Adrenomedullin (26-52), human	Inquiry
A05017	Adrenomedullin 5 (primate)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Conantokin-T, a naturally peptidic NMDA receptor antagonist

Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...

The Usage of Pentapeptide-31

of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...

Function of Gonadorelin in Infertility

Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...

Novel Peptide Drugs Treat Multiple Diseases (Part One)

Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...

Function of M871 as a Galanin GAL2 Receptor Antagonist

Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Source#	Synthetic
Storage	-20 ± 5 °C