Adrenomedullin (AM) (13-52), human

Adrenomedullin (AM) (13-52), human is a 40 amino acid peptide, which acts as an endothelium-dependent vasodilator agent.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1172

CAS No:154765-05-6

Synonyms/Alias:154765-05-6;N-[6-cyclopropyl-1-[(2-fluoro-6-methoxyphenyl)methyl]piperidin-3-yl]-3-imidazo[1,2-a]pyridin-6-yl-2,3,3a,4,5,6,7,7a-octahydro-1H-indazole-5-carboxamide;Adrenomedullin (AM) (13-52), human;Adrenomedullin (13-52) (human);BDBM154765;DA-70609;US8999957, Table 3, Compound 37;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C31H39FN6O2
M.W/Mr.
546.7
Sequence
One Letter Code: SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys16-Cys21)
three Letter Code: Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21)

Adrenomedullin (AM) (13-52), human is a synthetic peptide fragment corresponding to amino acids 13 through 52 of the full-length human adrenomedullin protein. As a bioactive peptide, it retains key functional domains associated with the physiological activities of native adrenomedullin, including vasodilatory, angiogenic, and immunomodulatory properties. Its truncated structure allows researchers to dissect the specific roles of the central and C-terminal regions of adrenomedullin, providing a focused tool for investigating peptide-receptor interactions, signaling pathways, and structure-function relationships. The ability to study this defined segment enhances the understanding of the endogenous peptide's activity and facilitates targeted exploration of its mechanisms in diverse biological systems.

Receptor Binding Studies: Researchers frequently employ the 13-52 fragment to investigate the molecular determinants of adrenomedullin receptor interactions. The peptide encompasses the primary receptor-binding domain, making it a valuable probe for characterizing affinity, selectivity, and activation dynamics at the calcitonin receptor-like receptor (CLR) and receptor activity-modifying proteins (RAMPs). By using this fragment in ligand-binding assays, scientists can delineate the contribution of specific amino acid residues to receptor engagement, supporting the development of novel ligands or antagonists for the adrenomedullin signaling axis.

Signal Transduction Research: The AM (13-52) fragment is instrumental in elucidating downstream signaling cascades triggered by adrenomedullin receptor activation. Its application in cell-based assays enables detailed analysis of cAMP production, MAPK pathway modulation, and intracellular calcium flux. By isolating the effects of this segment, researchers can distinguish between full-length peptide responses and those attributable to the active core, thereby refining models of peptide-mediated cell signaling and advancing the understanding of G protein-coupled receptor (GPCR) function.

Vascular Biology and Endothelial Function: The peptide is widely used to explore the role of adrenomedullin in vascular homeostasis, particularly its capacity to induce vasodilation and promote endothelial cell proliferation. Experimental models utilizing the 13-52 fragment provide insights into mechanisms of vascular tone regulation, nitric oxide synthesis, and angiogenic processes. Such studies contribute to mapping the functional domains responsible for vascular effects, supporting research into cardiovascular physiology and the molecular basis of endothelial responses.

Peptide Structure-Activity Relationship Analysis: The defined sequence of AM (13-52) is a valuable asset for structure-activity relationship (SAR) studies. By comparing the biological activity of this fragment with other truncated or modified forms, scientists can map critical residues and conformational features required for bioactivity. These investigations inform peptide engineering efforts, guiding the rational design of analogs with tailored receptor affinity or altered functional profiles for research purposes.

Immunological and Inflammatory Response Studies: The AM (13-52) fragment is also used to investigate the immunomodulatory properties of adrenomedullin, particularly its effects on cytokine production, leukocyte migration, and inflammatory mediator release. In vitro and ex vivo experiments utilizing this peptide help clarify its influence on immune cell signaling and the modulation of inflammatory pathways, providing a focused approach to dissecting the peptide's role in immune regulation and tissue homeostasis.

Length
50
InChI
InChI=1S/C31H39FN6O2/c1-40-28-4-2-3-25(32)24(28)18-38-17-22(9-11-27(38)19-5-6-19)34-31(39)20-7-10-26-23(15-20)30(36-35-26)21-8-12-29-33-13-14-37(29)16-21/h2-4,8,12-14,16,19-20,22-23,26-27,30,35-36H,5-7,9-11,15,17-18H2,1H3,(H,34,39)
InChI Key
XJOVNCGUQXEANC-UHFFFAOYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesEpitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide Synthesis ServicesCustom Conjugation ServicePeptide CDMOcGMP Peptide ServicePeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers