Adropin (34-76) (human, mouse, rat)

Adropin (34-76) (human, mouse, rat) trifluoroacetate salt represents a conserved region of the peptide used to explore metabolic signaling frameworks. Its amphipathic sequence supports folding analyses and receptor-binding studies across species. The fragment aids in studying structural determinants of peptide-protein communication. Applications include biosynthesis research and peptide engineering.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: C0022

CAS No:1802086-30-1

Synonyms/Alias:Adropin (34-76) (human, mouse, rat) trifluoroacetate salt;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₉₀H₂₉₃N₅₅O₆₈S₂
M.W/Mr.
4499.88
Sequence
One Letter Code: CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
three Letter Code: H-Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala-OH (Disulfide bond)
Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Modification ServicesPeptide Analysis ServicesEpitope Mapping ServicesPeptide Synthesis ServicesPeptide CDMOcGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers