ADWX 1

Potent and selective KV1.3 channel blocker (IC50 values are 0.0019 and 0.65 nM for KV1.3 and KV1.1, respectively). Inhibits CD4+ CCR7- T cell activation. It is a useful tool for studying the structure-function of Kv1.3 channel and auto-immunity pathways.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1063

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C169H281N57O46S7
M.W/Mr.
4071.86
Sequence
VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK(Modifications: Disulfide bridge: 7 - 27, 13 - 32, 17 - 34)
Labeling Target
Potassium channel
Appearance
White lyophilised solid
Purity
>98%
Activity
Blocker

ADWX 1 is a synthetic peptide compound engineered for advanced research applications in the fields of biochemistry, molecular biology, and peptide-based functional studies. As a custom-designed peptide, it features a unique amino acid sequence that enables selective interactions with specific biological targets, making it a valuable tool for probing protein-protein interactions, receptor binding, and intracellular signaling pathways. Its chemical stability and tailored structure provide researchers with a versatile platform for investigating complex biochemical phenomena and elucidating the mechanisms underlying peptide-mediated cellular processes.

Peptide-protein interaction studies: ADWX 1 is widely utilized in the analysis of peptide-protein interactions, serving as a probe to map binding sites, characterize affinity, and dissect interaction specificity within complex biological systems. By incorporating this peptide into binding assays or pull-down experiments, researchers can systematically explore the molecular determinants of protein recognition and modulation, thereby gaining insights into the structural and functional aspects of target proteins.

Signal transduction research: The compound's defined sequence allows it to function as a modulator or mimic of endogenous signaling peptides, facilitating the study of intracellular pathways regulated by peptide ligands. In cellular assays, it can be employed to activate, inhibit, or compete with natural ligands, enabling precise dissection of signaling cascades and downstream biological effects. This application is particularly relevant in efforts to unravel the roles of specific peptide motifs in cellular communication and regulatory networks.

Peptide synthesis validation: ADWX 1 is frequently used as a reference standard or model peptide in peptide synthesis laboratories. Its well-characterized sequence and predictable behavior in chromatographic and spectrometric analyses make it an ideal candidate for validating synthetic protocols, optimizing purification strategies, and benchmarking analytical instrumentation. By comparing experimental results with those obtained from this synthetic peptide, researchers can ensure the reliability and reproducibility of their peptide production workflows.

Structure-activity relationship (SAR) studies: The compound is instrumental in SAR investigations aimed at correlating peptide sequence variations with biological activity. By systematically modifying residues within the ADWX 1 scaffold, scientists can assess the impact of specific amino acid substitutions on binding affinity, stability, and functional potency. These studies are essential for rational peptide design, enabling the development of optimized analogs for both basic research and translational applications.

Biochemical assay development: ADWX 1 is also employed in the creation and optimization of biochemical assays that require defined peptide substrates or ligands. Its stability and sequence specificity make it suitable for use in enzyme kinetics experiments, receptor binding assays, and high-throughput screening platforms. By integrating this peptide into assay systems, researchers can achieve greater sensitivity, selectivity, and reproducibility, thereby advancing the development of robust and informative experimental protocols.

Source#
Synthetic
InChI
InChI=1S/C169H281N57O46S7/c1-13-88(8)132(221-128(236)75-192-161(265)130(180)86(4)5)163(267)213-111(68-124(179)232)151(255)222-131(87(6)7)162(266)204-99(41-21-28-55-174)144(248)216-114-77-274-278-81-118-157(261)223-133(90(10)228)164(268)212-110(67-123(178)231)137(241)191-74-127(235)196-95(37-17-24-51-170)138(242)215-116-79-276-275-78-115(217-145(249)102(48-49-122(177)230)203-140(244)100(44-31-58-187-168(181)182)200-152(256)113(76-227)214-149(253)108(65-93-70-185-83-193-93)209-141(245)97(201-153(114)257)39-19-26-53-172)155(259)207-106(63-85(2)3)148(252)205-104(42-22-29-56-175)165(269)225-60-33-46-120(225)160(264)220-117(80-277-279-82-119(219-150(254)109(210-156(116)260)66-94-71-186-84-194-94)158(262)224-134(91(11)229)166(270)226-61-34-47-121(226)159(263)206-105(167(271)272)43-23-30-57-176)154(258)202-98(40-20-27-54-173)142(246)211-112(69-129(237)238)147(251)195-89(9)135(239)189-72-125(233)198-103(50-62-273-12)146(250)199-101(45-32-59-188-169(183)184)143(247)208-107(64-92-35-15-14-16-36-92)136(240)190-73-126(234)197-96(139(243)218-118)38-18-25-52-171/h14-16,35-36,70-71,83-91,95-121,130-134,227-229H,13,17-34,37-69,72-82,170-176,180H2,1-12H3,(H2,177,230)(H2,178,231)(H2,179,232)(H,185,193)(H,186,194)(H,189,239)(H,190,240)(H,191,241)(H,192,265)(H,195,251)(H,196,235)(H,197,234)(H,198,233)(H,199,250)(H,200,256)(H,201,257)(H,202,258)(H,203,244)(H,204,266)(H,205,252)(H,206,263)(H,207,259)(H,208,247)(H,209,245)(H,210,260)(H,211,246)(H,212,268)(H,213,267)(H,214,253)(H,215,242)(H,216,248)(H,217,249)(H,218,243)(H,219,254)(H,220,264)(H,221,236)(H,222,255)(H,223,261)(H,224,262)(H,237,238)(H,271,272)(H4,181,182,187)(H4,183,184,188)
InChI Key
KOXLLJFKLFSCAF-UHFFFAOYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide Nucleic Acids SynthesisPeptide CDMOcGMP Peptide ServiceEpitope Mapping ServicesPeptide Analysis ServicesCustom Conjugation ServicePeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers

Creative Peptides customer logo 1 Creative Peptides customer logo 2 Creative Peptides customer logo 3 Creative Peptides customer logo 4 Creative Peptides customer logo 5 Creative Peptides customer logo 6 Creative Peptides customer logo 7 Creative Peptides customer logo 8 Creative Peptides customer logo 9 Creative Peptides customer logo 10 Creative Peptides customer logo 11 Creative Peptides customer logo 12 Creative Peptides customer logo 13 Creative Peptides customer logo 14 Creative Peptides customer logo 15 Creative Peptides customer logo 16 Creative Peptides customer logo 17 Creative Peptides customer logo 18 Creative Peptides customer logo 19 Creative Peptides customer logo 20 Creative Peptides customer logo 21 Creative Peptides customer logo 22 Creative Peptides customer logo 23 Creative Peptides customer logo 24 Creative Peptides client partner 1 Creative Peptides client partner 2 Creative Peptides client partner 3 Creative Peptides client partner 4 Creative Peptides client partner 5 Creative Peptides client partner 6 Creative Peptides client partner 7 Creative Peptides client partner 8 Creative Peptides client partner 9 Creative Peptides client partner 10 Creative Peptides client partner 11 Creative Peptides client partner 12 Creative Peptides client partner 13 Creative Peptides client partner 14 Creative Peptides client partner 15 Creative Peptides client partner 16 Creative Peptides client partner 17 Creative Peptides client partner 18 Creative Peptides client partner 19 Creative Peptides client partner 20 Creative Peptides client partner 21 Creative Peptides client partner 22 Creative Peptides client partner 23 Creative Peptides client partner 24