Agitoxin 2

Agitoxin-2 is an effective and selective blocker of the Shaker type voltage-gated Kv1.3 and Kv1.1 channels, which inhibits Kv1.1 with an IC50 value of around 140 pM and Kv1.3 with an IC50 value of around 200 pM.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R0978

CAS No:168147-41-9

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C169H278N54O48S8
M.W/Mr.
4090.87
Sequence
GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK
(Disulfide bridge: Cys8 and Cys28,Cys14 and Cys33,Cys18 and Cys35)
Labeling Target
Kv1.1 and Kv1.3 channels
Appearance
White lyophilized solid
Purity
>98%
Activity
Blocker

Agitoxin 2 is a peptide toxin originally isolated from the venom of the scorpion *Leiurus quinquestriatus hebraeus*. As a member of the scorpion toxin family, it is characterized by its potent and selective inhibition of voltage-gated potassium channels, particularly the Kv1 subfamily. The peptide's unique three-dimensional structure, stabilized by multiple disulfide bridges, underpins its high affinity and specificity for its molecular targets. Due to these properties, Agitoxin 2 has become a valuable biochemical tool in neurophysiology and ion channel research, enabling detailed exploration of potassium channel function, modulation, and pharmacology in both basic and applied scientific contexts.

Electrophysiological research: Agitoxin 2 is extensively employed in electrophysiological studies to probe the functional roles of Kv1.3 and related potassium channels in neuronal and non-neuronal cells. Its high-affinity binding and channel-blocking activity allow for precise dissection of potassium current components in patch-clamp experiments. By selectively inhibiting specific channel subtypes, researchers can delineate the contributions of individual channels to membrane excitability, action potential shaping, and signal transduction pathways, thereby advancing understanding of cellular electrophysiology and ion channel diversity.

Ion channel pharmacology: The peptide serves as a reference inhibitor in pharmacological profiling of potassium channel modulators. When used in competitive binding assays or functional screening platforms, Agitoxin 2 enables the validation of new channel-targeting compounds and helps characterize their selectivity profiles. Its well-documented mechanism of action provides a benchmark for evaluating the potency and specificity of novel small molecules or biologics, facilitating the development and optimization of ion channel-targeted research tools.

Structural biology: The defined interaction between Agitoxin 2 and its potassium channel targets makes it a valuable ligand for structural studies. It has been utilized in co-crystallization experiments and NMR analyses to resolve channel-toxin complexes at atomic resolution. These structural insights inform the molecular basis of channel gating, selectivity, and toxin recognition, supporting rational design of channel modulators and advancing structure-guided drug discovery initiatives.

Neurotoxin mechanism studies: As a prototypical scorpion toxin, Agitoxin 2 is frequently used to investigate the molecular mechanisms underlying neurotoxin-channel interactions. Its application in mutagenesis and mapping studies has elucidated key determinants of channel binding and inhibition, contributing to a broader understanding of neurotoxin specificity and evolution. Such research aids in deciphering the structural motifs responsible for high-affinity channel blockade and informs the engineering of peptide-based research probes.

Peptide engineering and biosensor development: The robust structure and well-characterized activity of Agitoxin 2 make it a template for peptide engineering efforts. Researchers employ it as a scaffold to generate analogs with altered selectivity, stability, or pharmacokinetic properties. Additionally, its specific channel-binding capability has been harnessed in the design of biosensors and molecular imaging agents aimed at detecting potassium channel expression or activity in live cells and tissues. These engineered derivatives expand the utility of the native peptide in advanced biochemical and biotechnological applications.

Source#
Synthetic
InChI
InChI=1S/C169H278N54O48S8/c1-14-86(7)130-161(264)200-101(40-22-27-55-173)163(266)220-59-31-45-117(220)157(260)213-112-79-276-279-82-115(154(257)219-133(90(11)227)166(269)223-62-33-46-118(223)156(259)201-102(167(270)271)41-23-28-56-174)211-145(248)104(66-92-71-183-83-189-92)203-151(254)111-78-275-277-80-113(152(255)216-130)210-141(244)98(48-49-120(176)228)199-155(258)116-44-32-60-221(116)164(267)109(76-225)193-126(234)74-188-159(262)132(89(10)226)218-153(256)114(212-148(251)108(75-224)207-160(263)128(84(3)4)215-147(250)106(68-122(178)230)206-162(265)131(87(8)15-2)217-158(261)119-47-34-61-222(119)165(268)129(85(5)6)214-123(231)70-175)81-278-274-77-110(149(252)198-100(51-64-273-13)143(246)204-105(67-121(177)229)146(249)196-96(42-29-57-184-168(179)180)137(240)194-95(140(243)209-111)39-21-26-54-172)208-136(239)93(37-19-24-52-170)191-125(233)73-187-135(238)103(65-91-35-17-16-18-36-91)202-139(242)97(43-30-58-185-169(181)182)195-142(245)99(50-63-272-12)192-124(232)72-186-134(237)88(9)190-144(247)107(69-127(235)236)205-138(241)94(197-150(112)253)38-20-25-53-171/h16-18,35-36,71,83-90,93-119,128-133,224-227H,14-15,19-34,37-70,72-82,170-175H2,1-13H3,(H2,176,228)(H2,177,229)(H2,178,230)(H,183,189)(H,186,237)(H,187,238)(H,188,262)(H,190,247)(H,191,233)(H,192,232)(H,193,234)(H,194,240)(H,195,245)(H,196,249)(H,197,253)(H,198,252)(H,199,258)(H,200,264)(H,201,259)(H,202,242)(H,203,254)(H,204,246)(H,205,241)(H,206,265)(H,207,263)(H,208,239)(H,209,243)(H,210,244)(H,211,248)(H,212,251)(H,213,260)(H,214,231)(H,215,250)(H,216,255)(H,217,261)(H,218,256)(H,219,257)(H,235,236)(H,270,271)(H4,179,180,184)(H4,181,182,185)
InChI Key
MNSSWZUIQUJZTG-UHFFFAOYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide CDMOEpitope Mapping ServicesPeptide Analysis ServicescGMP Peptide ServicePeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers