Amylin (8-37), rat
Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.
Online Inquiry
| CAT# | R1187 |
| CAS | 138398-61-5 |
| Synonyms/Alias | Amylin (8-37) (mouse, rat) |
| M.F/Formula | C₁₄₀H₂₂₇N₄₃O₄₃ |
| M.W/Mr. | 3200.61 |
| Sequence | One Letter Code: ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
three Letter Code: Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 |
Write a review
Ask a question
My Review for Amylin (8-37), rat
Required fields are marked with *
×
Ask a Question for Amylin (8-37), rat
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
