Amyloid β-peptide (1-40) rat

Amyloid β-peptide (1-40) (rat) is the prone-to-aggregation product of amyloid precursor protein proteolytic cleavage, and is the major constituent of senile plaques observed in the brain of Alzheimer's disease.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1192

CAS No:144409-98-3

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₉₀H₂₉₁N₅₁O₅₇S
M.W/Mr.
4233.76
Sequence
One Letter Code: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
three Letter Code: Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Amyloid β-peptide (1-40) rat is a synthetic peptide that corresponds to the 1-40 amino acid sequence of the rat amyloid beta protein, a key fragment derived from the amyloid precursor protein (APP). As a member of the amyloid beta peptide family, it is widely recognized for its central role in neurodegenerative disease research, particularly in the study of amyloidogenesis and protein aggregation. The rat isoform of this peptide is frequently employed in comparative studies due to its sequence homology with human amyloid beta, while also offering species-specific differences that are critical for translational neuroscience models. Its biochemical properties, including the propensity to form oligomers and fibrils under defined conditions, make it an essential reagent for elucidating the molecular mechanisms underlying protein misfolding and aggregation.

Protein aggregation studies: Researchers utilize the rat amyloid β(1-40) peptide to investigate the fundamental processes that govern amyloid fibril formation. By providing a controlled system for in vitro aggregation assays, this peptide enables the detailed characterization of nucleation, elongation, and maturation phases of amyloidogenesis. Insights gained from such studies help clarify the physicochemical parameters influencing peptide self-assembly, informing the broader understanding of protein misfolding disorders.

Neurotoxicity modeling: The peptide serves as a valuable tool in modeling amyloid-induced cytotoxicity in neuronal and glial cell cultures. Its ability to form soluble oligomers and insoluble fibrils allows scientists to assess the impact of distinct aggregate species on cell viability, oxidative stress responses, and synaptic function. These investigations are instrumental in identifying cellular pathways susceptible to amyloid toxicity and in screening potential neuroprotective agents.

Comparative neuropathology: Because the rat amyloid β(1-40) sequence exhibits key differences from the human counterpart, it is frequently used in comparative studies to dissect species-dependent variations in amyloid aggregation kinetics and pathogenicity. Such research is critical for interpreting results from transgenic rodent models of neurodegenerative diseases and for understanding the evolutionary aspects of amyloidogenic processes.

Biophysical and structural analysis: The peptide is extensively employed in biophysical experiments, including circular dichroism, nuclear magnetic resonance, and electron microscopy, to elucidate the conformational transitions and structural polymorphism of amyloid assemblies. These studies provide high-resolution insights into the secondary and tertiary structures adopted by the peptide under various environmental conditions, advancing the field of structural biology as it pertains to amyloidogenic proteins.

Screening of aggregation modulators: In drug discovery and chemical biology, the rat amyloid β(1-40) peptide is a preferred substrate for high-throughput screening of small molecules, peptides, or antibodies that can modulate amyloid aggregation. By serving as a reproducible and well-characterized target, it enables the identification and mechanistic evaluation of compounds that influence the aggregation pathway, offering a platform for the development of aggregation inhibitors and molecular probes relevant to neurodegeneration research.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesEpitope Mapping ServicesPeptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide Modification ServicesPeptide CDMOcGMP Peptide ServicePeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers