Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFGF |
Activity | Antimicrobial |
Host Chemicals | Staphylococcus aureus subsp. aureus USA300_FPR3757 |
Length | 44 |
SwissProt ID | Q2FHR3 |
1. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
3. Emu oil in combination with other active ingredients for treating skin imperfections
4. Cationic cell-penetrating peptides are potent furin inhibitors
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.