CAT# | P03030 |
M.F/Formula | C181H290N56O52 |
M.W/Mr. | 4082.7 |
Sequence | SVSEIQLNHNLGKHLNSLERVEWLRKKLQDVHNF |
Length | 34 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P03002 | pTH (73-84) (human) | Inquiry | ||
P03054 | Hypercalcemia Malignancy Factor (7-34), amide, human | Inquiry | ||
P03012 | Parathyroid Hormone (13-34), human | Inquiry | ||
P03017 | [Tyr34] Parathyroid Hormone (7-34), amide, bovine | Inquiry | ||
P03014 | (Tyr43)-pTH (43-68) (human) | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...
ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...
Introduce of lipopeptide Lipopeptide (peptidolipid), also known as acylpeptide, is composed of hydrophilic peptide bond and l ...
Icatibant, sold under the trade name Firazyr, is a plasma kallikrein inhibitor and the bradykinin B2 receptor an ...
The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...