Home > Product > Catalog Peptides > β-Amyloid Mutations > [Asp22] b-Amyloid (1-40)

β-Amyloid Mutations

[Asp22] b-Amyloid (1-40)

Price Inquiry
CAT#
A13262
Sequence
DAEFRHDSGYEVHHQKLVFFADDVGSNKGAIIGLMVGGVV
M.W/Mr.
4315.9
Molecular Formula
C193H293N53O58S1
Length
40

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.