Keywords Search Google Search Search

Attractin

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A40001
Sequence	DQNCDIGNITSQCQMQHKNCEDANGCDTIIEECKTSMVERCQNQEFESAAGSTTLGPQ

CAT#	Product Name	Inquiry
X03393	PM_10837963	Inquiry
X17729	UP_P01205	Inquiry
X15411	PM_8808737	Inquiry
X03027	PM_10646526	Inquiry
X14894	PM_8514736	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Function of Aviptadil Acetate on the Treatment of Pulmonary Arterial Hypertension

Aviptadil acetate, the nonproprietary or generic name for a vasoactive intestinal peptide (VIP), is a synthetic ...

The source and function of tripeptide-1 kollaren

of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...

MEN 11270, a peptide antagonist at the human B2 kinin receptor

MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...

The Function of Depreotide in Tumor Receptor Imaging

Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...

Trimetazidine and related diseases

Trimetazidine is a partial fatty acid oxidation inhibitor that inhibits 3-ketoacyl CoA thiolase, one of the enzymes of fatty ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Length	56
Modifications	N-linked (GlcNAc...);Disulfide bond(3)