Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | NPVTCIRSGAICHPGFCPGRYKHIGVCGVPLIKCCK |
Activity | Antimicrobial |
Host Chemicals | Macaca mulatta |
Length | 36 |
SwissProt ID | B0LFF4 |
2. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. Cationic cell-penetrating peptides are potent furin inhibitors
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.