CAT# | AF2536 |
Sequence | RRLHPQHQRFPRERPWPKPLSLPLPRPGPRPWPKPL |
Activity | Antimicrobial |
Host Chemicals | Bos primigenius | Length | 36 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF142 | Lichenin | Inquiry | ||
AF033 | Defensin precursor | Inquiry | ||
AF1810 | Dermaseptin-J5 | Inquiry | ||
AF2265 | Brevinin-2LTc antimicrobial peptide | Inquiry | ||
AF2912 | Arasin-likeSp | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...