CAT# | AF2966 |
Sequence | TKYYGNGVYCNSKKCWVDWGQAAGGIGQTVVXGWLGGAIPGK |
Activity | Antimicrobial |
Host Chemicals | Lactobacillus sakei | Length | 42 | SwissProt ID | P80493 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1205 | RV-23 | Inquiry | ||
AF2612 | Oxyopinin-2d | Inquiry | ||
AF1457 | Caerin-2.2 | Inquiry | ||
AF2533 | Beta-defensin 103 | Inquiry | ||
AF3132 | Pseudo-hevein | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
Peginesatide sold under the brand name Omontys, formerly Hematide, is a synthetic peptide consisting of two 21 a ...
KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...
5. Synthetic Peptides Targeting CD36 Attenuate Lipopolysaccharide-Induced InflammationSynthetic amphipathic helical peptides ...