Home > Product > Antimicrobial Peptides > Bacteriocin bavaricin-MN

Antimicrobial Peptides

Bacteriocin bavaricin-MN

Price Inquiry
CAT#
AF2966
Sequence
TKYYGNGVYCNSKKCWVDWGQAAGGIGQTVVXGWLGGAIPGK
Host Chemicals
Lactobacillus sakei
Length
42
Activity
Antimicrobial
SwissProt ID
P80493

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.