CAT# | AF2975 |
Sequence | AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH |
Activity | Antibacterial |
Host Chemicals | Carnobacterium maltaromaticum | Length | 43 | SwissProt ID | P38579 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF704 | Uperin-2.3 | Inquiry | ||
AF1138 | Dahlein 4.2 | Inquiry | ||
AF3136 | Beta-defensin14 | Inquiry | ||
AF728 | RugosinA - like peptide | Inquiry | ||
AF202 | Temporin-1BYa | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...
Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...