Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | TKYYGNGVYCNSKKCWVDWGTAQGCIDVVIGQLGGGIPGKGKC |
Activity | Antibacterial |
Host Chemicals | Carnobacterium divergens |
Length | 43 |
SwissProt ID | P84962 |
3. Implications of ligand-receptor binding kinetics on GLP-1R signalling
4. The spatiotemporal control of signalling and trafficking of the GLP-1R
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.