CAT# | AF3037 |
Sequence | TKYYGNGVYCNSKKCWVDWGTAQGCIDVVIGQLGGGIPGKGKC |
Activity | Antibacterial |
Host Chemicals | Carnobacterium divergens | Length | 43 | SwissProt ID | P84962 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF564 | Napin-like polypeptide | Inquiry | ||
AF2238 | Brevinin-2-RA22 antimicrobial peptide | Inquiry | ||
AF1117 | Pseudin-3 | Inquiry | ||
AF3257 | Dm-AMP1 | Inquiry | ||
AF923 | Nigroain-B antimicrobial peptide | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
MEN 10376 (Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Lys-NH2) is an analogue of Neurokinin A (NKA), which has a selective af ...
Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...
Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...
GR 82334 is a spirolactam analog with the structure of [[(S, S) Pro-Leu (spiro-γ-lactam)]9,10, Trp11] Physalaemi ...
In the respiratory tract, there are tachykinin P (SP) and neurokinin A (NKA) in capsaicin-sensitive primary affe ...