Keywords Search Google Search Search

Bacteriocin 31

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2983
Sequence	ATYYGNGLYCNKQKCWVDWNKASREIGKIIVNGWVQHGPWAPR
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF960	Ocellatin-4	Inquiry
AF1324	Ascaphin-6	Inquiry
AF1542	Dermaseptin-B5	Inquiry
AF2951	OGC-RA1 peptide precursor	Inquiry
AF019	Microcin 7	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The application of nafarelin acetate in hormonal therapy

Nafarelin acetate is a gonadotropin-releasing hormone (GnRH) agonist which is as effective as danazol in the tre ...

Medical value of catestatin

Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...

What is GHK and Copper Peptide?

Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...

Function of perindopril erbumine in hypertension

Perindopril erbumine is an angiotensioncon vertingenzyme (ACE) inhibitor without sulfhydryl group. It is a chi ...

Function of Timonacic in Cancer

Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Enterococcus faecalis YI717
Length	43