Home > Product > Antimicrobial Peptides > Bacteriocin L-1077

Antimicrobial Peptides

Bacteriocin L-1077

Price Inquiry
CAT#
AF2682
Sequence
TNYGNGVGVPDAIMAGIIKLIFIFNIRQGYNFGKKAT
Host Chemicals
Lactobacillus salivarius 1077 (NRRL B-50053)
Length
37
Activity
Gram+ & Gram-,

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.