CAT# | AF2682 |
Sequence | TNYGNGVGVPDAIMAGIIKLIFIFNIRQGYNFGKKAT |
Activity | Gram+ & Gram-, |
Host Chemicals | Lactobacillus salivarius 1077 (NRRL B-50053) | Length | 37 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2583 | Ir-Def1 | Inquiry | ||
AF3242 | Oxyopinin 1 | Inquiry | ||
AF785 | Phylloseptin 12 | Inquiry | ||
AF1082 | Temporin-LF4 antimicrobial peptide precursor | Inquiry | ||
AF2947 | Ostricacin-4 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...
Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...
Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...
Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...