CAT# | AF2649 |
Sequence | KYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGFW |
Activity | Antibacterial |
Host Chemicals | Leuconostoc mesenteroides | Length | 37 | SwissProt ID | P38577 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF947 | Nigrocin-2LVb | Inquiry | ||
AF1978 | AC-AMP2 | Inquiry | ||
AF245 | UyCT2 | Inquiry | ||
AF523 | CPF-PG1 | Inquiry | ||
AF2154 | Dermaseptin-8 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...
In the respiratory tract, there are tachykinin P (SP) and neurokinin A (NKA) in capsaicin-sensitive primary affe ...
Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...
Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...