CAT# | AF3007 |
Sequence | KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGGSYHC |
Activity | Antibacterial |
Host Chemicals | Lactobacillus plantarum A-1 | Length | 43 | SwissProt ID | C7G1H4 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2211 | Brevinin-2DYb | Inquiry | ||
AF2730 | CRS4C-3d | Inquiry | ||
AF2601 | Gaegurin-4 | Inquiry | ||
AF249 | Dahlein-1.2 | Inquiry | ||
AF1433 | Caerin 1.20 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Pep2m, a peptide inhibitor of GluA2 subunit binding to NSF, reduces α-amino- 3-hydroxy-5-methyl-isoxazolepropion ...
DAPTA (D-[Ala]-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-amide), D-Ala-Peptide T amide, is one of analogue of peptide T, which ...
The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...
Delcasertib, also known as KAI-9803, is a 23-amino acid peptide and δ-protein kinase C (δ-PKC) inhibitor. KAI-9 ...
MEN 10376 (Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Lys-NH2) is an analogue of Neurokinin A (NKA), which has a selective af ...