CAT# | AF1888 |
Sequence | FVYGNGVTSILVQAQFLVNGQRRFFYTPDK |
Activity | Antibacterial |
Host Chemicals | Paenibacillus polymyxa | Length | 30 | SwissProt ID | P86395 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF750 | PP30 | Inquiry | ||
AF2104 | Dermaseptin-L1 | Inquiry | ||
AF012 | Fusaricidin B | Inquiry | ||
AF1814 | Dermaseptin-01 | Inquiry | ||
AF2164 | Brevinin-2SN2_2 antimicrobial peptide precursor | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...
Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
st-Ht31, a protein kinase A (PKA)-anchoring inhibitor, greatly induces robust cholesterol or phospholipid effl ...