Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | FVYGNGVTSILVQAQFLVNGQRRFFYTPDK |
Activity | Antibacterial |
Host Chemicals | Paenibacillus polymyxa |
Length | 30 |
SwissProt ID | P86395 |
3. Emu oil in combination with other active ingredients for treating skin imperfections
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.