CAT# | AF2474 |
Sequence | VNYGNGVSCSKTKCSVNWGIITHQAFRVTSGVASG |
Activity | Antibacterial |
Host Chemicals | Paenibacillus polymyxa | Length | 35 | SwissProt ID | P86394 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF580 | BmKb1 | Inquiry | ||
AF2480 | Alo-3 | Inquiry | ||
AF1160 | Ranatuerin-2PRc precursor | Inquiry | ||
AF2052 | Arminin-1a | Inquiry | ||
AF1661 | Dermaseptin-C3 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...
Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
Jingzhaotoxin-III (β-TRTX-Cj1α) is a kind of sodium channel gating modifier which is from the tarantula Chilobra ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...