Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | VNYGNGVSCSKTKCSVNWGIITHQAFRVTSGVASG |
Activity | Antibacterial |
Host Chemicals | Paenibacillus polymyxa |
Length | 35 |
SwissProt ID | P86394 |
1. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
2. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
3. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
4. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.