BDS I

Potent and selective Kv3.4 potassium channel blocker (IC50 = 47 nM). Also potent TTX-sensitive sodium channel agonist (EC50 = 3 nM). Exhibits neuroprotective effect.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1056

Synonyms/Alias:Blood depressing substance 1

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C210H297N57O56S6
M.W/Mr.
4708.37
Sequence
AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH(Disulfide bridge: Cys4 and Cys39,Cys6 and Cys32,Cys22 and Cys40)
Labeling Target
Potassium channel
Appearance
White lyophilised solid
Purity
>95%
Activity
Blocker

BDS I, also known as Sea Anemone Toxin I or Anemonia sulcata toxin I, is a peptide toxin derived from the venom of the Mediterranean sea anemone. As a member of the sea anemone toxin family, BDS I is characterized by its unique disulfide-rich structure and potent bioactivity against specific ion channels, particularly voltage-gated potassium channels (Kv). Its high specificity and well-defined peptide sequence make it a valuable molecular tool in neurophysiological and ion channel research, providing insights into the structural and functional dynamics of membrane proteins. The compound's ability to modulate ion channel activity has positioned it as an essential reagent for dissecting neuronal signaling pathways and for advancing our understanding of excitable cell physiology.

Ion Channel Research: BDS I is extensively utilized in the investigation of voltage-gated potassium channels, especially Kv3 and Kv4 subtypes. By selectively inhibiting these channels, researchers can delineate their distinct physiological roles in neuronal excitability, cardiac repolarization, and signal transduction. The peptide's high affinity and subtype selectivity enable precise mapping of channel function, contributing to the development of detailed electrophysiological models and advancing the field of cellular neurobiology.

Neuroscience Studies: The toxin serves as a powerful probe in studies of synaptic transmission and neuronal firing patterns. Its ability to alter action potential dynamics by modulating potassium currents allows for controlled manipulation of neuronal output in both in vitro and ex vivo systems. Through these applications, BDS I aids in unraveling the molecular mechanisms underlying excitability disorders and supports the exploration of new targets for neurological research.

Pharmacological Screening: BDS I is employed as a reference inhibitor in high-throughput screening assays designed to identify novel modulators of Kv channels. Its well-characterized activity profile provides a benchmark for evaluating the efficacy and selectivity of new small molecules, peptides, or biologics. This application is particularly valuable in the early stages of drug discovery, where precise pharmacological tools are essential for target validation and lead optimization.

Peptide Structure-Activity Relationship (SAR) Analysis: The defined sequence and structural motifs of BDS I make it an exemplary scaffold for SAR studies. By introducing targeted modifications or synthesizing analogs, researchers can investigate the relationship between peptide structure and functional activity. These studies facilitate the rational design of new peptide-based modulators with tailored selectivity and potency, expanding the toolkit available for ion channel research and therapeutic exploration.

Electrophysiological Method Development: BDS I is frequently incorporated into protocols for patch-clamp and voltage-clamp experiments, serving as a standard modulator for validating assay systems. Its predictable and robust effects on potassium channel currents enhance the reliability and reproducibility of electrophysiological measurements. This contributes to methodological advancements in the study of membrane excitability, supporting both basic research and applied technology development in neurophysiology and pharmacology.

Source#
Synthetic
InChI
InChI=1S/C210H297N57O56S6/c1-13-107(7)169-199(313)247-134(74-106(5)6)179(293)239-130(42-27-67-222-210(218)219)175(289)227-95-167(284)259-171(111(11)270)201(315)258-153-103-329-328-99-149(191(305)248-143(79-117-54-62-124(275)63-55-117)205(319)266-71-32-47-158(266)197(311)250-145(208(322)323)82-120-88-220-104-232-120)255-193(307)152-102-327-326-101-151(256-198(312)156-45-30-68-263(156)203(317)110(10)233-173(287)109(9)213)190(304)242-137(75-113-33-16-15-17-34-113)182(296)253-150(192(306)251-146(96-268)177(291)229-91-164(281)235-132(40-23-25-65-212)204(318)264-69-28-43-154(264)195(309)231-94-163(280)234-129(41-26-66-221-209(216)217)174(288)226-92-166(283)238-142(85-168(285)286)184(298)241-133(73-105(3)4)180(294)244-139(186(300)260-169)80-118-86-223-127-37-20-18-35-125(118)127)100-325-324-98-148(189(303)243-138(78-116-52-60-123(274)61-53-116)181(295)240-131(39-22-24-64-211)178(292)249-144(81-119-87-224-128-38-21-19-36-126(119)128)206(320)267-72-31-46-157(267)196(310)246-141(84-160(215)277)187(301)261-170(108(8)14-2)200(314)257-152)254-183(297)140(83-159(214)276)245-188(302)147(97-269)252-202(316)172(112(12)271)262-185(299)136(77-115-50-58-122(273)59-51-115)237-165(282)93-228-176(290)135(76-114-48-56-121(272)57-49-114)236-162(279)90-225-161(278)89-230-194(308)155-44-29-70-265(155)207(153)321/h15-21,33-38,48-63,86-88,104-112,129-158,169-172,223-224,268-275H,13-14,22-32,39-47,64-85,89-103,211-213H2,1-12H3,(H2,214,276)(H2,215,277)(H,220,232)(H,225,278)(H,226,288)(H,227,289)(H,228,290)(H,229,291)(H,230,308)(H,231,309)(H,233,287)(H,234,280)(H,235,281)(H,236,279)(H,237,282)(H,238,283)(H,239,293)(H,240,295)(H,241,298)(H,242,304)(H,243,303)(H,244,294)(H,245,302)(H,246,310)(H,247,313)(H,248,305)(H,249,292)(H,250,311)(H,251,306)(H,252,316)(H,253,296)(H,254,297)(H,255,307)(H,256,312)(H,257,314)(H,258,315)(H,259,284)(H,260,300)(H,261,301)(H,262,299)(H,285,286)(H,322,323)(H4,216,217,221)(H4,218,219,222)
InChI Key
NHDQBZJQNKDJOQ-UHFFFAOYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide Synthesis ServicescGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide CDMOPeptide Modification ServicesCustom Conjugation ServicePeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers