Keywords Search Google Search Search

Beta-Amyloid (8-40)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13211
M.W/Mr.	3459
Sequence	SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

CAT#	Product Name	Inquiry
A13264	[Cys7]-beta-Amyloid (1-40)	Inquiry
A13294	[Asn6,13,14]-beta-Amyloid (1-42)	Inquiry
A13015	Beta-Amyloid (1-10), mouse, rat	Inquiry
A13312	[Met]-beta-Amyloid (1-42), mouse, rat	Inquiry
A13248	Beta-Amyloid (4-42)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

UFP-101-A Peptide Antagonist Selective for the Nociceptin/Orphanin FQ Receptor

Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...

Function of BIM 189 As An Antagonist

BIM 189 is one of the most potent bombesin antagonists known in the guinea pig and 3T3 cell systems but has 40% ...

Palmitoyl Hexapeptide-12, a natural powerful antiager

Introduce of lipopeptide Lipopeptide (peptidolipid), also known as acylpeptide, is composed of hydrophilic peptide bond and l ...

A high affinity blocker for inward-rectifier K+ channels-Tertiapin-Q

Tertiapin-Q (TPN-Q) is a small compact protein that contains twenty-one amino acids, which derived from bee veno ...

Function of propofol in anaesthesia

Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: