Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4230.7 |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV |
Length | 39 |
1. Myotropic activity of allatostatins in tenebrionid beetles
3. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
4. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.