Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Activity | Antibacterial, Antifungal |
Host Chemicals | Homo sapiens |
Length | 40 |
3. TMEM16F and dynamins control expansive plasma membrane reservoirs
4. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.