Home > Product > Antimicrobial Peptides > Beta-amyloid peptide(1-40)

Antimicrobial Peptides

Beta-amyloid peptide(1-40)

Price Inquiry
CAT#
AF2820
Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Host Chemicals
Homo sapiens
Length
40
Activity
Antibacterial, Antifungal

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.