CAT# | AF2821 |
Sequence | EGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPQIKCCR |
Activity | Antibacterial |
Host Chemicals | Bos taurus | Length | 40 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2754 | Abaecin isoform 1 | Inquiry | ||
AF1274 | Brevinin-1SPd | Inquiry | ||
AF2296 | Brevinin-2HS3 | Inquiry | ||
AF414 | Antifungal protein Pr-2 | Inquiry | ||
AF2026 | Bacteriocin lactocin-705 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The voltage-gated Kv1.3 channel in effector memory T cells serves as a new therapeutic target for multiple scler ...
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
AdTx1, also called as ρ-Da1a, is a polypeptide of 65 amino acids stabilized by four disulfide bonds, which has a ...
Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...
NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...