Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLAPQIKCCR |
Activity | Antibacterial |
Host Chemicals | Bos taurus |
Length | 40 |
SwissProt ID | P46167 |
1. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
2. Implications of ligand-receptor binding kinetics on GLP-1R signalling
4. TMEM16F and dynamins control expansive plasma membrane reservoirs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.