CAT# | AF2490 |
Sequence | DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCK |
Activity | Antimicrobial |
Host Chemicals | Pan troglodytes | Length | 36 | SwissProt ID | Q9TT12 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2875 | Beta-defensin 4 , BNBD-4 | Inquiry | ||
AF1911 | Hyfl I | Inquiry | ||
AF3061 | Drosomycin | Inquiry | ||
AF1806 | Brevinin-2Td | Inquiry | ||
AF2845 | LEAP-2 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
2. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
4. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
5. Emu oil in combination with other active ingredients for treating skin imperfections
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...
Anisomycin, also known by its trade name flagecidin, is a bacterial pyrrolidine antibiotic mostly isolated from ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...
Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...