Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | DSIQCFQKNNTCHTNQCPYFQDEIGTCYDRRGKCCQ |
Activity | Antibacterial |
Host Chemicals | Mus musculus |
Length | 36 |
SwissProt ID | Q70KL3 |
1. The spatiotemporal control of signalling and trafficking of the GLP-1R
5. Myotropic activity of allatostatins in tenebrionid beetles
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.